Tyr-LL-37 trifluoroacetate salt,CAS :2022972-74-1

H-Tyr-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH trifluoroacetate salt

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-904	0.5mg	130.00	- +	+ Add to cart
R-M-904	1mg	220.00	- +	+ Add to cart

Product description

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	2022972-74-1
Sequence	YLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Synonyms	[Tyr133]- Cationic Antimicrobial Protein 18 (134-170) (human), Tyr- hCAP-18 (134-170)
Molecular Formula	C₂₁₄H₃₄₉N₆₁O₅₅
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document